Recombinant Mouse IGF1 Protein (Active) (RMPP-00230091)
Cat. No.: RMPP-00230091
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
100 μg
50 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | ELISA; SDS-PAGE; WB |
| Key Features | Expression system: Wheat germ; Suitable for: ELISA, SDS-PAGE, WB |
Protein Information
| UniProt ID | P23759 |
|---|---|
| Molecular Weight | 38 kDa including tags |
| Sequence | GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGY QYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEK LKSSQMEQFT |
| Sequence Similarities | Belongs to the paired homeobox family. Contains 1 homeobox DNA-binding domain. Contains 1 paired domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Nucleus. |
| Function | Probable transcription factor. May have a role in myogenesis. |
| Involvement in Disease | Defects in PAX7 are a cause of rhabdomyosarcoma type 2 (RMS2). It is a form of rhabdomyosarcoma, a highly malignant tumor of striated muscle derived from primitive mesenchimal cells and exhibiting differentiation along rhabdomyoblastic lines. Rhabdomyosarcoma is one of the most frequently occurring soft tissue sarcomas and the most common in children. It occurs in four forms: alveolar, pleomorphic, embryonal and botryoidal rhabdomyosarcomas. Note=A chromosomal aberration involving PAX7 is found in rhabdomyosarcoma. Translocation t(1;13)(p36;q14) with FOXO1. The resulting protein is a transcriptional activator. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
