Recombinant Mouse IL-1 beta Protein (Active) (RMPP-00230148)
Cat. No.: RMPP-00230148
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
10 μg
100 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | ELISA; WB; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Suitable for: ELISA, WB, SDS-PAGE |
Protein Information
| UniProt ID | P34820 |
|---|---|
| Molecular Weight | 35 kDa including tags |
| Sequence | KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQ GYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV |
| Sequence Similarities | Belongs to the TGF-beta family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted. |
| Function | Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
