Recombinant Mouse M-CSF Protein (RMPP-00230657)
Cat. No.: RMPP-00230657
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
100 μg
1 mg
Product Features
| Source | E.coli |
|---|---|
| Purity | ≥ 95% SDS-PAGE. Purity determined by reducing and non-reducing SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 1.000 Eu/µg |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: ≥ 95% SDS-PAGE; Endotoxin level: ≤ 1.000 Eu/µg; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P09038 |
|---|---|
| Molecular Weight | 16 kDa |
| Sequence | MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH VKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLES NNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Sequence Similarities | Belongs to the heparin-binding growth factors family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. Nucleus. Exported from cells by an endoplasmic reticulum (ER)/Golgi-independent mechanism. Unconventional secretion of FGF2 occurs by direct translocation across the plasma membrane. Binding of exogenous FGF2 to FGFR facilitates endocytosis followed by translocation of FGF2 across endosomal membrane into the cytosol. Nuclear import from the cytosol requires the classical nuclear import machinery, involving proteins KPNA1 and KPNB1, as well as CEP57. |
| Tissue Specificity | Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue. |
| Function | Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis. |
| Post-translational Modifications | Phosphorylation at Tyr-215 regulates FGF2 unconventional secretion.Several N-termini starting at positions 94, 125, 126, 132, 143 and 162 have been identified by direct sequencing. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. Constituents: 0.16% Sodium phosphate, 0.29% Sodium chlorideLyophilized from a sterile (0.2 micron) filtered aqueous solution. |
|---|
For research use only. Not for clinical use.
