Recombinant Mouse TGF beta Receptor I Protein (Active) (RMPP-00230650)
Cat. No.: RMPP-00230650
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
5 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P26842 |
|---|---|
| Molecular Weight | 46 kDa including tags |
| Sequence | TPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVS FSPDHHTRP HCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECT ECDPLPNPSLTARSSQALSPH PQPTHLPYVSEMLEARTAGHMQTLADF RQLPARTLSTHWPPQRSLCSSDFIRI |
| Sequence Similarities | Contains 3 TNFR-Cys repeats. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Found in most T-lymphocytes. |
| Function | Receptor for CD70/CD27L. May play a role in survival of activated T-cells. May play a role in apoptosis through association with SIVA1. |
| Post-translational Modifications | Phosphorylated and O-glycosylated. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA). pH: 7.4Constituents: 0.6% Tris, 0.75% Glycine, 5% TrehaloseLyophilized from 0.22 µm filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
