Recombinant Mouse VEGF 165A Protein (RMPP-00230958)
Cat. No.: RMPP-00230958
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
10 μg
1 mg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | WB; ELISA |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: WB, ELISA |
Protein Information
| UniProt ID | P13612 |
|---|---|
| Sequence | RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSI VTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKF GENFASCQAG |
| Sequence Similarities | Belongs to the integrin alpha chain family. Contains 7 FG-GAP repeats. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Domain | The SG1 motif is involved in binding to chondroitin sulfate glycosaminoglycan and cell adhesion. |
| Function | Integrins alpha-4/beta-1 (VLA-4) and alpha-4/beta-7 are receptors for fibronectin. They recognize one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. They are also receptors for VCAM1. Integrin alpha-4/beta-1 recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-4/beta-7 is also a receptor for MADCAM1. It recognizes the sequence L-D-T in MADCAM1. On activated endothelial cells integrin VLA-4 triggers homotypic aggregation for most VLA-4-positive leukocyte cell lines. It may also participate in cytolytic T-cell interactions with target cells. |
| Post-translational Modifications | Phosphorylation on Ser-1027 inhibits PXN binding. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
