Recombinant rat CXCL1/GRO alpha Protein (Active) (RMPP-00230950)
Cat. No.: RMPP-00230950
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
5 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | WB; ELISA |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: WB, ELISA |
Protein Information
| UniProt ID | P20702 |
|---|---|
| Sequence | HECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSIS SRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPL SLLASVHQLQ |
| Sequence Similarities | Belongs to the integrin alpha chain family. Contains 7 FG-GAP repeats. Contains 1 VWFA domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Predominantly expressed in monocytes and granulocytes. |
| Domain | The integrin I-domain (insert) is a VWFA domain. Integrins with I-domains do not undergo protease cleavage. |
| Function | Integrin alpha-X/beta-2 is a receptor for fibrinogen. It recognizes the sequence G-P-R in fibrinogen. It mediates cell-cell interaction during inflammatory responses. It is especially important in monocyte adhesion and chemotaxis. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
