Recombinant rat Leptin Protein (Active) (RMPP-00230854)
Cat. No.: RMPP-00230854
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
1mg
10 mg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 80% Purified via His tag. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 80% Purified via His tag; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | Q04917 |
|---|---|
| Molecular Weight | 32 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMGDREQLLQRARLAEQ AERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSI EQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQ YESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQ PTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSY KDSTLIMQLLRDNLTLWTSDQQDEEAGEGN |
| Sequence Similarities | Belongs to the 14-3-3 family. |
| Protein Length | Full length protein |
| Tissue Specificity | Expressed mainly in the brain and present in other tissues albeit at lower levels. |
| Function | Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 7.50Constituents: 0.012% Benzamidine, 0.003% PMSF, 0.02% DTT, 0.6% HEPES, 50% Glycerol |
|---|
For research use only. Not for clinical use.
