Recombinant rhesus Monkey CD40 Protein (Fc Chimera) (RMPP-00230852)
Cat. No.: RMPP-00230852
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
100 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | P12814 |
|---|---|
| Molecular Weight | 31 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSEFMDHYDSQQTNDYMQPEEDWDRDLLL DPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGE RLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLG MIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKD GLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAE DIVGTARPDEKAIMTYVSSFYHAF |
| Sequence Similarities | Belongs to the alpha-actinin family. Contains 1 actin-binding domain. Contains 2 CH (calponin-homology) domains. Contains 2 EF-hand domains. Contains 4 spectrin repeats. |
| Protein Length | Protein fragment |
| Cellular Localization | Cytoplasm > cytoskeleton. Cytoplasm > myofibril > sarcomere > Z line. Colocalizes with MYOZ2 and PPP3CA at the Z-line of heart and skeletal muscle. |
| Function | F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 89% PBS, 10% Glycerol (glycerin, glycerine) |
|---|
For research use only. Not for clinical use.
