CD80 Peptide (RMPP-00231044)
Cat. No.: RMPP-00231044
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
1mg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | WB; SDS-PAGE; ELISA |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: WB, SDS-PAGE, ELISA |
Protein Information
| UniProt ID | P13591 |
|---|---|
| Molecular Weight | 37 kDa including tags |
| Sequence | EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEI RLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP |
| Sequence Similarities | Contains 2 fibronectin type-III domains. Contains 5 Ig-like C2-type (immunoglobulin-like) domains. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted and Cell membrane. |
| Function | This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.79% Tris HCl, 0.3% Glutathione |
|---|
For research use only. Not for clinical use.
