Recombinant Human Stabilin 2 Protein (RMPP-00230720)
Cat. No.: RMPP-00230720
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
10 μg
Customer Size
Product Features
| Source | Baculovirus infected Sf9 cells |
|---|---|
| Purity | > 95% Densitometry. Affinity purified. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | proprietary tag N-Terminus |
| Modifications | mutated T204D |
| Form | Liquid |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: Baculovirus infected Sf9 cells; Purity: > 95% Densitometry; Active: Yes; Tags: proprietary tag N-Terminus; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P36897 |
|---|---|
| Molecular Weight | 66 kDa including tags |
| Sequence | RDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTGLPLLVQRTIARDIV LQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRH ENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLA LSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAV RHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGL VFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPN RWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM |
| Sequence Similarities | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. Contains 1 GS domain. Contains 1 protein kinase domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Found in all tissues examined, mostthis product in placenta and leastthis product in brain and heart. |
| Function | On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for TGF-beta. |
| Involvement in Disease | Defects in TGFBR1 are the cause of Loeys-Dietz syndrome type 1A (LDS1A); also known as Furlong syndrome or Loeys-Dietz aortic aneurysm syndrome (LDAS). LDS1 is an aortic aneurysm syndrome with widespread systemic involvement. The disorder is characterized by arterial tortuosity and aneurysms, craniosynostosis, hypertelorism, and bifid uvula or cleft palate. Other findings include exotropy, micrognathia and retrognathia, structural brain abnormalities, intellectual deficit, congenital heart disease, translucent skin, joint hyperlaxity and aneurysm with dissection throughout the arterial tree.Defects in TGFBR1 are the cause of Loeys-Dietz syndrome type 2A (LDS2A). LDS2 is an aortic aneurysm syndrome with widespread systemic involvement. Physical findings include prominent joint laxity, easy bruising, wide and atrophic scars, velvety and translucent skin with easily visible veins, spontaneous rupture of the spleen or bowel, diffuse arterial aneurysms and dissections, and catastrophic complications of pregnancy, including rupture of the gravid uterus and the arteries, either during pregnancy or in the immediate postpartum period. LDS2 is characterized by the absence of craniofacial abnormalities with the exception of bifid uvula that can be present in some patients.Defects in TGFBR1 are the cause of aortic aneurysm familial thoracic type 5 (AAT5). Aneurysms and dissections of the aorta usually result from degenerative changes in the aortic wall. Thoracic aortic aneurysms and dissections are primarily associated with a characteristic histologic appearance known as 'medial necrosis' in which there is degeneration and fragmentation of elastic fibers, loss of smooth muscle cells, and an accumulation of basophilic ground substance. |
| Post-translational Modifications | Phosphorylated at basal levels in the absence of ligand binding. Activated by multiple phosphorylation, mainly in the GS region. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.50Constituents: 0.79% Tris HCl, 0.88% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol (glycerin, glycerine) This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
