Banner

Desmin Peptide (RMPP-00231040)

Cat. No.: RMPP-00231040

Category: Recombinant Protein

Research Area: Epigenetics and Nuclear Signaling

INQUIRY 1mg Customer Size

Product Features

Source Wheat germ
Nature Recombinant
Animal Free No
Form Liquid
Applications WB; SDS-PAGE; ELISA
Key Features Expression system: Wheat germ; Suitable for: WB, SDS-PAGE, ELISA

Protein Information

UniProt ID P17483
Molecular Weight 33 kDa including tags
Sequence MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQP EAGFGRRAACTVQRYAACRD
Sequence Similarities Belongs to the Antp homeobox family. Deformed subfamily. Contains 1 homeobox DNA-binding domain.
Protein Length Protein fragment
Cellular Localization Nucleus.
Developmental Stage Expressed in whole embryos and fetuses at 5-9 weeks from conception.
Function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Storage & Shipping

Shipping and Storage Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl

For research use only. Not for clinical use.