Recombinant Human RSBN1/Rosbin Protein (RMPP-00230542)
Cat. No.: RMPP-00230542
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
2 μg
Customer Size
Product Features
| Source | Mammalian |
|---|---|
| Purity | > 85% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | MS; SDS-PAGE |
| Key Features | Expression system: Mammalian; Purity: > 85% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: MS, SDS-PAGE |
Protein Information
| UniProt ID | P01137 |
|---|---|
| Molecular Weight | 44 kDa |
| Sequence | LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLA LYNSTRDRVAGESADPEPEPEADYYAKEVTRVLMVDRNNAIYDKTKDITH SIYMFFNTSDIREAVPEPPLLSRAELRLQRFKSTVEQHVELYQKYSNNSW RYLGNRLLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKD NVLHVEINGISPKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRR |
| Sequence Similarities | Belongs to the TGF-beta family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted > extracellular space > extracellular matrix. |
| Tissue Specificity | Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Co-localizes with ASPN in chondrocytes within OA lesions of articular cartilage. |
| Function | Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. |
| Involvement in Disease | Defects in TGFB1 are the cause of Camurati-Engelmann disease (CE); also known as progressive diaphyseal dysplasia 1 (DPD1). CE is an autosomal dominant disorder characterized by hyperostosis and sclerosis of the diaphyses of long bones. The disease typically presents in early childhood with pain, muscular weakness and waddling gait, and in some cases other features such as exophthalmos, facial paralysis, hearing difficulties and loss of vision. |
| Post-translational Modifications | Glycosylated.The precursor is cleaved into mature TGF-beta-1 and LAP, which remains non-covalently linked to mature TGF-beta-1 rendering it inactive. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.2Constituents: PBS, 6% TrehaloseLyophilized from. |
|---|
For research use only. Not for clinical use.
