Recombinant rat PDGF AA Protein (RMPP-00230820)
Cat. No.: RMPP-00230820
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
10 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% HPLC. SDS-PAGE ≥ 95% |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC; MS |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, HPLC, MS |
Protein Information
| UniProt ID | P08571 |
|---|---|
| Molecular Weight | 36 kDa |
| Molecular Weight Information | Predicted MW is 35830.06 Da (+/-10 Da by ESI-TOF). Observed MW is 35834.28 Da. |
| Sequence | TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPF LKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLK ELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLK PGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPH KFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSA PRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELP EVDNLTLDGNPFLVPGTALPHEGSMNSGVVPAC |
| Sequence Similarities | Contains 11 LRR (leucine-rich) repeats. |
| Protein Length | Full length protein |
| Cellular Localization | Cell membrane. |
| Tissue Specificity | Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages. |
| Function | Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules. |
| Post-translational Modifications | N- and O- glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.4Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
