Dishevelled 2 Peptide (RMPP-00231039)
Cat. No.: RMPP-00231039
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
1mg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | WB; SDS-PAGE; ELISA |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: WB, SDS-PAGE, ELISA |
Protein Information
| UniProt ID | P31269 |
|---|---|
| Molecular Weight | 56 kDa including tags |
| Sequence | MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPD FSPCSFQSKATVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAA AAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTH TLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANW LHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQV KIWFQNRRMKMKKINKDRAKDE |
| Sequence Similarities | Belongs to the Abd-B homeobox family. Contains 1 homeobox DNA-binding domain. |
| Protein Length | Full length protein |
| Cellular Localization | Nucleus. |
| Function | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. |
| Involvement in Disease | Note=A chromosomal aberration involving HOXA9 is found in a form of acute myeloid leukemia. Translocation t(7;11)(p15;p15) with NUP98.Note=A chromosomal aberration involving HOXA9 may contribute to disease progression in chronic myeloid leukemia. Translocation t(7;17)(p15;q23) with MSI2. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
