Banner

Human BCL9 Peptide (RMPP-00230532)

Cat. No.: RMPP-00230532

Category: Growth Factors & Cytokines

Research Area: Cardiovascular

INQUIRY 100 μg Customer Size

Product Features

Source HEK 293 cells
Purity ≥ 95% SDS-PAGE. ≥ 95% HPLC
Nature Recombinant
Endotoxin Level ≤ 0.005 Eu/µg
Animal Free Yes
Form Lyophilized
Applications MS; HPLC; SDS-PAGE; Biological Activity
Key Features Expression system: HEK 293 cells; Purity: ≥ 95% SDS-PAGE; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes; Suitable for: MS, HPLC, SDS-PAGE, Biological Activity

Protein Information

UniProt ID P21802
Molecular Weight 40 kDa
Molecular Weight Information Mass determination by ESI TOF: Predicted MW is 39583.33 +/- 10Da. Observed MW is 39591.53
Sequence RPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVIS WTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFM VNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPA ANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESV VPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVG GDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTD KEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITA SPDYLE
Sequence Similarities Belongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily. Contains 3 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 protein kinase domain.
Protein Length Protein fragment
Cellular Localization Secreted and Cell membrane.
Function Receptor for acidic and basic fibroblast growth factors.
Involvement in Disease Defects in FGFR2 are the cause of Crouzon syndrome (CS); also called craniofacial dysostosis type I (CFD1). CS is an autosomal dominant syndrome characterized by craniosynostosis (premature fusion of the skull sutures), hypertelorism, exophthalmos and external strabismus, parrot-beaked nose, short upper lip, hypoplastic maxilla, and a relative mandibular prognathism.Defects in FGFR2 are a cause of Jackson-Weiss syndrome (JWS). JWS is an autosomal dominant craniosynostosis syndrome characterized by craniofacial abnormalities and abnormality of the feet: broad great toes with medial deviation and tarsal-metatarsal coalescence.Defects in FGFR2 are a cause of Apert syndrome (APRS); also known as acrocephalosyndactyly type 1 (ACS1). APRS is a syndrome characterized by facio-cranio-synostosis, osseous and membranous syndactyly of the four extremities, and midface hypoplasia. The craniosynostosis is bicoronal and results in acrocephaly of brachysphenocephalic type. Syndactyly of the fingers and toes may be total (mitten hands and sock feet) or partial affecting the second, third, and fourth digits. Intellectual deficit is frequent and often severe, usually being associated with cerebral malformations.Defects in FGFR2 are a cause of Pfeiffer syndrome (PS); also known as acrocephalosyndactyly type V (ACS5). PS is characterized by craniosynostosis (premature fusion of the skull sutures) with deviation and enlargement of the thumbs and great toes, brachymesophalangy, with phalangeal ankylosis and a varying degree of soft tissue syndactyly. Three subtypes of Pfeiffer syndrome have been described: mild autosomal dominant form (type 1); cloverleaf skull, elbow ankylosis, early death, sporadic (type 2); craniosynostosis, early demise, sporadic (type 3).Defects in FGFR2 are the cause of Beare-Stevenson cutis gyrata syndrome (BSCGS). BSCGS is an autosomal dominant condition is characterized by the furrowed skin disorder of cutis gyrata, acanthosis nigricans, craniosynostosis, craniofacial dysmorphism, digital anomalies, umbilical and anogenital abnormalities and early death.Defects in FGFR2 are the cause of familial scaphocephaly syndrome (FSPC); also known as scaphocephaly with maxillary retrusion and mental retardation. FSPC is an autosomal dominant craniosynostosis syndrome characterized by scaphocephaly, macrocephaly, hypertelorism, maxillary retrusion, and mild intellectual disability. Scaphocephaly is the most common of the craniosynostosis conditions and is characterized by a long, narrow head. It is due to premature fusion of the sagittal suture or from external deformation.Defects in FGFR2 are a cause of lacrimo-auriculo-dento-digital syndrome (LADDS); also known as Levy-Hollister syndrome. LADDS is a form of ectodermal dysplasia, a heterogeneous group of disorders due tothis product development of two or more ectodermal structures. LADDS is an autosomal dominant syndrome characterized by aplastic/hypoplastic lacrimal and salivary glands and ducts, cup-shaped ears, hearing loss, hypodontia and enamel hypoplasia, and distal limb segments anomalies. In addition to these cardinal features, facial dysmorphism, malformations of the kidney and respiratory system andthis product genitalia have been reported. Craniosynostosis and severe syndactyly are not observed.Defects in FGFR2 are the cause of Antley-Bixler syndrome (ABS). ABS is a multiple congenital anomaly syndrome characterized by craniosynostosis, radiohumeral synostosis, midface hypoplasia, malformed ears, arachnodactyly and multiple joint contractures. ABS is a heterogeneous disorder and occurs with and withoutthis product genitalia in both sexes.

Storage & Shipping

Shipping and Storage Shipped at Room Temperature. Store at Room Temperature.
pH: 7.4Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.