Recombinant Human Activin Receptor Type IA (mutated Q207D) Protein (RMPP-00230509)
Cat. No.: RMPP-00230509
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
10 μg
5 μg
Product Features
| Source | CHO cells |
|---|---|
| Purity | ≥ 95% SDS-PAGE. At least 95% by HPLC analysis. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | HPLC; SDS-PAGE; Functional Studies |
| Key Features | Expression system: CHO cells; Purity: ≥ 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: HPLC, SDS-PAGE, Functional Studies |
Protein Information
| Molecular Weight | 37 kDa |
|---|---|
| Sequence | SYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKLSRRQKQLCRREP GLAETLRDAAHLGLLECQFQFRHERWNCSLEGRMGLLKRGFKETAFLYAV SSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKF LSNFLGSKRGNKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVR TCWKQLSPFRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTK GLAPRSGDLVYMEDSPSFCRPSKYSPGTAGRVCSREASCSSLCCGRGYDT QSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH |
| Protein Length | Full length protein |
| Cellular Localization | Secreted: extracellular space: extracellular matrix. |
| Relevance | Wnt9b is a member of the WNT family and is a ligand for members of the frizzled family of seven transmembrane receptors. The WNT gene family consists of structurally related genes that encode secreted signaling proteins. Wnt9b is expressed in the inductive epithelia and is essential for the development of mesonephric and metanephric tubules and caudal extension of the Müllerian duct. Wnt9b plays a central role in the regulation of mesenchymal to epithelial transitions underlying organogenesis of the mammalian urogenital system. The gene is clustered with WNT3, another family member, in the chromosome 17q21 region. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Constituents: 0.12% Tris, 0.56% Potassium chloride, 1.45% Sodium chloride, 0.375% CHAPS This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
