Human c-Myc Peptide (RMPP-00230984)
Cat. No.: RMPP-00230984
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
1mg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | WB; ELISA; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Suitable for: WB, ELISA, SDS-PAGE |
Protein Information
| Molecular Weight | 36 kDa including tags |
|---|---|
| Sequence | AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAG MINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSATCNKF |
| Protein Length | Protein fragment |
| Cellular Localization | Cell Membrane |
| Relevance | Jagged 2 is a Notch ligand involved in the mediation of Notch signaling. Jagged 2 is expressed in heart, placenta and skeletal muscle and to a lesser extend in pancreas. Very low expression in brain, lung, liver and kidney. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. Jagged 2 is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for Jagged 2. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
