Human Oct4 Peptide (RMPP-00230983)
Cat. No.: RMPP-00230983
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
1mg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | WB; ELISA; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Suitable for: WB, ELISA, SDS-PAGE |
Protein Information
| UniProt ID | Q99612 |
|---|---|
| Molecular Weight | 55 kDa including tags |
| Sequence | MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYV SASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLE TNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLGSSVTSAPPS SPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVH RCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRH FRKHTGAKPF |
| Sequence Similarities | Belongs to the krueppel C2H2-type zinc-finger protein family. Contains 3 C2H2-type zinc fingers. |
| Protein Length | Protein fragment |
| Cellular Localization | Nucleus. |
| Tissue Specificity | Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus. |
| Domain | The acidic N-terminal part may favor interaction with the basic domain of transcription factors. |
| Function | Transcriptional activator (By similarity). Binds a GC box motif. Could play a role in B-cell growth and development. |
| Involvement in Disease | Defects in KLF6 are a cause of gastric cancer (GASC); also called gastric cancer intestinal or stomach cancer. Gastric cancer is a malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.Defects in KLF6 are a cause of prostate cancer (PC). Prostate cancer is a malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
