Recombinant Human BCRP/ABCG2 Protein (RMPP-00230492)
Cat. No.: RMPP-00230492
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
2 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% HPLC. SDS-PAGE ≥95% |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | HPLC; SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Suitable for: HPLC, SDS-PAGE |
Protein Information
| UniProt ID | P08887 |
|---|---|
| Molecular Weight | 39 kDa |
| Molecular Weight Information | Predicted MW is 38595.37 Da (+/- 10 Da by ESI-TOF). Observed MW is 38595.37 Da. |
| Sequence | LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGS HPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQL SCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ ESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPP ANITVTAVARNPR |
| Sequence Similarities | Belongs to the type I cytokine receptor family. Type 3 subfamily. Contains 1 fibronectin type-III domain. Contains 1 Ig-like C2-type (immunoglobulin-like) domain. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted and Basolateral cell membrane. |
| Tissue Specificity | Isoform 2 is expressed in peripheral blood mononuclear cells and weakly found in urine and serum. |
| Domain | The two fibronectin type-III-like domains, contained in the N-terminal part, form together a cytokine-binding domain.The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding. |
| Function | Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.Low concentration of a soluble form of IL6 receptor acts as an agonist of IL6 activity. |
| Post-translational Modifications | A short soluble form may also be released from the membrane by proteolysis. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.40Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose |
|---|
For research use only. Not for clinical use.
