Human Wnt3a Peptide (RMPP-00230981)
Cat. No.: RMPP-00230981
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
1mg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | WB; ELISA; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Suitable for: WB, ELISA, SDS-PAGE |
Protein Information
| UniProt ID | O43255 |
|---|---|
| Molecular Weight | 61 kDa including tags |
| Sequence | MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPA AAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLV CNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLH HTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQG EDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVL LIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFD TAIAHLFADNGNLGINVTISTCCP |
| Sequence Similarities | Belongs to the SINA (Seven in absentia) family. Contains 1 RING-type zinc finger. Contains 1 SIAH-type zinc finger. |
| Protein Length | Full length protein |
| Cellular Localization | Cytoplasm. Nucleus. Predominantly cytoplasmic (Probable). Partially nuclear. |
| Tissue Specificity | Widely expressed at low level. |
| Domain | The RING-type zinc finger domain is essential for ubiquitin ligase activity.The SBD domain (substrate-binding domain) mediates the homodimerization and the interaction with substrate proteins. It is related to the TRAF family. |
| Function | E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (POU2AF1, PML, NCOR1), a cell surface receptor (DCC), an antiapoptotic protein (BAG1), and a protein involved in synaptic vesicle function in neurons (SYP). It is thereby involved in apoptosis, tumor suppression, cell cycle, transcription and signaling processes. Has some overlapping function with SIAH1. Triggers the ubiquitin-mediated degradation of TRAF2, whereas SIAH1 can not. Promotes monoubiquitination of SNCA. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
