Recombinant Human TIE2 Protein (Active) (RMPP-00230697)
Cat. No.: RMPP-00230697
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
5 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 98% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: > 98% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P12104 |
|---|---|
| Molecular Weight | 16 kDa including tags |
| Sequence | AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVK ESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGN ELNTVREIIGDELVQTYVYEGVEAKRIFKKD |
| Sequence Similarities | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
| Protein Length | Full length protein |
| Cellular Localization | Cytoplasm. |
| Tissue Specificity | Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum. |
| Domain | Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior. |
| Function | FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 95% PBS, 5% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
