Native Human Serum Albumin Protein (Biotin) (RMPP-00230275)
Cat. No.: RMPP-00230275
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
1mg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. Lyophilized from 0. 22µm filtered solution |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | Fc tag N-Terminus |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: Fc tag N-Terminus; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P01344 |
|---|---|
| Molecular Weight | 34 kDa |
| Molecular Weight Information | The protein migrates as 35-38 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation. |
| Sequence | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRS CDLALLETYCATPAKSE |
| Sequence Similarities | Belongs to the insulin family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted. |
| Function | The insulin-like growth factors possess growth-promoting activity. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development.Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3. |
| Involvement in Disease | Epigenetic changes of DNA hypomethylation in IGF2 are a cause of Silver-Russell syndrome (SIRS). SIRS is a clinically heterogeneous condition characterized by severe intrauterine growth retardation, poor postnatal growth, craniofacial features such as a triangular shaped face and a broad forehead, body asymmetry, and a variety of minor malformations. |
| Post-translational Modifications | O-glycosylated with a core 1 or possibly core 8 glycan. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.4Constituents: 5% Trehalose, 0.75% Glycine, 0.605% Tris This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
