Native Human Serum Albumin Protein (FITC) (RMPP-00230985)
Cat. No.: RMPP-00230985
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
1mg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | WB; ELISA; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Suitable for: WB, ELISA, SDS-PAGE |
Protein Information
| UniProt ID | O95936 |
|---|---|
| Molecular Weight | 37 kDa including tags |
| Sequence | PYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTS PTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRL |
| Sequence Similarities | Contains 1 T-box DNA-binding domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Nucleus. |
| Tissue Specificity | Expressed in CD8+ T-cells. |
| Developmental Stage | Detected at 7 weeks of development in the forebrain floorplate of the CNS. Expressed within the mantle layer and migrating neuroblasts of the telencephalon at 12.5 weeks of development. |
| Function | Functions as a transcriptional activator playing a crucial role during development. Functions in trophoblast differentiation and later in gastrulation, regulating both mesoderm delamination and endoderm specification. Plays a role in brain development being required for the specification and the proliferation of the intermediate progenitor cells and their progeny in the cerebral cortex. Also involved in the differentiation of CD8+ T-cells during immune response regulating the expression of lytic effector genes. |
| Involvement in Disease | Note=A translocation t(3;10)(p24;q23) located 215 kb 3' to the EOMES gene but leading to loss of its expression was identified in a large consanguineous family. Homozygous silencing produces microcephaly associated with corpus callosum agenesis, bilateral polymicrogyria, ventricular dilatation and a small cerebellum. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
