Recombinant Human 2B4 Protein (Tagged) (Biotin) (RMPP-00230514)
Cat. No.: RMPP-00230514
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
50 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 97% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | HPLC; SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: > 97% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: HPLC, SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P05231 |
|---|---|
| Molecular Weight | 21 kDa |
| Sequence | MAPVLPGEDSKNVAAPHSQPLTSSERIDKHIRYILDGISALRKETCNRSN MCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYL EYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLL TKLQAQNQWLQDMTTHLILRSFKEFLQSNLRALRQM |
| Sequence Similarities | Belongs to the IL-6 superfamily. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. |
| Involvement in Disease | Genetic variations in IL6 are associated with susceptibility to rheumatoid arthritis systemic juvenile (RASJ). An inflammatory articular disorder with systemic-onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis.Note=A IL6 promoter polymorphism is associated with a lifetime risk of development of Kaposi sarcoma in HIV-infected men. |
| Post-translational Modifications | N- and O-glycosylated. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store under desiccating conditions. pH: 7.40Constituent: 100% PBSLyophilized from a 0.2 µM filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
