Recombinant Human PCSK9 Protein (Active) (Biotin) (RMPP-00230558)
Cat. No.: RMPP-00230558
Category: Actin Binding Proteins
Research Area: Signal Transduction
INQUIRY
50 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Suitable for: SDS-PAGE |
Protein Information
| UniProt ID | Q04771 |
|---|---|
| Sequence | Theoretical Sequence MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGC FQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF HLEGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Sequence Similarities | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. Contains 1 GS domain. Contains 1 protein kinase domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells. |
| Function | On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin. May be involved for left-right pattern formation during embryogenesis. |
| Involvement in Disease | Defects in ACVR1 are a cause of fibrodysplasia ossificans progressiva (FOP). FOP is a rare autosomal dominant disorder of skeletal malformations and progressive extraskeletal ossification. Heterotopic ossification in FOP begins in childhood and can be induced by trauma or may occur without warning. Bone formation is episodic and progressive, leading to extra-articular ankylosis of all major joints of the axial and appendicular skeleton, rendering movement impossible. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles. Constituents: 10% Trehalose, 1% Human serum albumin |
|---|
For research use only. Not for clinical use.
