Recombinant Human Aggrecan Protein (RMPP-00230239)
Cat. No.: RMPP-00230239
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
2 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Conjugation | APC |
| Form | Liquid |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: > 90% SDS-PAGE; Active: Yes; Tags: His tag C-Terminus; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P28907 |
|---|---|
| Molecular Weight | 31 kDa including tags |
| Sequence | VPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGA FISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDM FTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTV SRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWV IHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPE DSSCTSEI |
| Sequence Similarities | Belongs to the ADP-ribosyl cyclase family. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma. |
| Developmental Stage | Preferentially expressed at both early and late stages of the B and T-cell maturation. It is also detected on erythroid and myeloid progenitors in bone marrow, where the level of surface expression was shown to decrease during differentiation of blast-forming unit E to colony-forming unit E. |
| Function | Synthesizes cyclic ADP-ribose, a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. Store In the Dark. pH: 7.40Constituents: 0.13% Sodium phosphate, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol (glycerin, glycerine) This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
