Recombinant Human Angiotensin Converting Enzyme 1 Protein (RMPP-00230498)
Cat. No.: RMPP-00230498
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 98% SDS-PAGE. >98% as determined by SDS-PAGE and HPLC. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | HPLC; SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: > 98% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: HPLC, SDS-PAGE, Functional Studies |
Protein Information
| Molecular Weight | 22 kDa |
|---|---|
| Sequence | LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMV KVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGV GGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQ LPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC |
| Protein Length | Full length protein |
| Cellular Localization | Secreted |
| Relevance | Various hormones are secreted from the anterior pituitary during development and growth. Prolactin is a growth factor secreted by the anterior pituitary that is necessary for the proliferation and differentiation of the mammary glands. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Constituent: PBS0.2 µm filtered This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
