Recombinant Human CD44 Protein (Active) (RMPP-00230141)
Cat. No.: RMPP-00230141
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
100 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | ELISA; WB; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: ELISA, WB, SDS-PAGE |
Protein Information
| UniProt ID | P07766 |
|---|---|
| Molecular Weight | 46 kDa including tags |
| Sequence | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRNDKNIGGDEDD KNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENC MEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQ RGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
| Sequence Similarities | Contains 1 Ig-like (immunoglobulin-like) domain. Contains 1 ITAM domain. |
| Protein Length | Full length protein |
| Cellular Localization | Membrane. |
| Function | The CD3 complex mediates signal transduction. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.