Recombinant Human ANGPTL7 Protein (Active) (RMPP-00230801)
Cat. No.: RMPP-00230801
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
20 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Tags: His tag C-Terminus; Suitable for: SDS-PAGE, HPLC |
Protein Information
| UniProt ID | Q96PL5 |
|---|---|
| Molecular Weight | 15 kDa including tags |
| Sequence | HAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHI FRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQ VGNLSKEDTVILQVAAPSVGSLSPSAVDHHHHHH |
| Sequence Similarities | Belongs to the immunoglobulin superfamily. BTN/MOG family. Contains 1 B30. 2/SPRY domain. Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Cell membrane. Cytoplasm. |
| Tissue Specificity | Expressed in erythroid-enriched bone marrow (at protein level). Highly expressed in bone marrow and to a lower extent in leukocytes, thymus, lymph node and spleen. |
| Developmental Stage | Expressed in fetal liver blood cells (at protein level). Highly expressed in fetal liver. |
| Function | Possible role as a cell-adhesion or receptor molecule of erythroid cells. |
| Post-translational Modifications | Glycosylated. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. pH: 7.20Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride |
|---|
For research use only. Not for clinical use.
