Recombinant Human Notch1 Protein (RMPP-00230359)
Cat. No.: RMPP-00230359
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
10 μg
Customer Size
Product Features
| Source | Baculovirus infected insect cells |
|---|---|
| Purity | > 90% SDS-PAGE. Affinity purified |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Liquid |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: Baculovirus infected insect cells; Purity: > 90% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P15509 |
|---|---|
| Molecular Weight | 36 kDa including tags |
| Sequence | ADPLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKK NRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGR EGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCP YYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIE RFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGT ENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFG SDDGHHHHHH |
| Sequence Similarities | Belongs to the type I cytokine receptor family. Type 5 subfamily. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted and Cell membrane. |
| Domain | The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.The box 1 motif is required for JAK interaction and/or activation. |
| Function | Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. |
| Involvement in Disease | Defects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4). A rare lung disorder due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid-Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: PBS, 10% Glycerol (glycerin, glycerine) This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
