Recombinant Human c-Myc (mutated T73A) Protein (RMPP-00231025)
Cat. No.: RMPP-00231025
Category: Kinases
Research Area: Signal Transduction
INQUIRY
50 μg
Customer Size
Product Features
| Source | Baculovirus infected Sf9 cells |
|---|---|
| Purity | > 95% SDS-PAGE. Affinity purified. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | proprietary tag N-Terminus |
| Form | Liquid |
| Applications | WB; SDS-PAGE |
| Key Features | Expression system: Baculovirus infected Sf9 cells; Purity: > 95% SDS-PAGE; Tags: proprietary tag N-Terminus; Suitable for: WB, SDS-PAGE |
Protein Information
| UniProt ID | Q96RU8 |
|---|---|
| Molecular Weight | 70 kDa including tags |
| Sequence | MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRL SECSSPPDYLSPPGSPCSPQPPPAAPGAGGGSGSAPGPSRIADYLLLPLA EREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVI LGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSA IVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVS PEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQ FCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSE IGTSDQIVPEYQEDSDISSFFC |
| Sequence Similarities | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. Tribbles subfamily. Contains 1 protein kinase domain. |
| Protein Length | Full length protein |
| Tissue Specificity | Expressed in most human tissues with the highest levels in skeletal muscle, thyroid gland, pancreas, peripheral blood leukocytes, and bone marrow. |
| Domain | The protein kinase domain is predicted to be catalytically inactive. |
| Function | Interacts with MAPK kinases and regulates activation of MAP kinases. May not display kinase activity. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.50Constituents: 25% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF |
|---|
For research use only. Not for clinical use.
