Recombinant Human TLE 1 Protein (RMPP-00230430)
Cat. No.: RMPP-00230430
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
10 μg
Customer Size
Product Features
| Source | CHO cells |
|---|---|
| Purity | > 95% SDS-PAGE. >95% by HPLC. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE; HPLC |
| Key Features | Expression system: CHO cells; Purity: > 95% SDS-PAGE; Active: Yes; Suitable for: Functional Studies, SDS-PAGE, HPLC |
Protein Information
| UniProt ID | Q2MKA7 |
|---|---|
| Molecular Weight | 27 kDa |
| Sequence | SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIR QVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQEALYL HKGRCYPACPEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCGFRK GSEERTRRVLHAPGGDHTTCSDTKETRKCTVRRTPCPEGQKRRKGGQGRR ENANRHPARKNSKEPRSNSRRHKGQQQPQPGTTGPLTSVGPTWAQ |
| Sequence Similarities | Belongs to the R-spondin family. Contains 2 FU (furin-like) repeats. Contains 1 TSP type-1 domain. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Tissue Specificity | Abundantly expressed in adrenal glands, ovary, testis, thyroid and trachea but not in bone marrow, spinal cord, stomach, leukocytes colon, small intestine, prostate, thymus and spleen. |
| Domain | The FU repeats are required for activation and stabilization of beta-catenin. |
| Function | Activator of the beta-catenin signaling cascade, leading to TCF-dependent gene activation. Acts both in the canonical Wnt/beta-catenin-dependent pathway, possibly via a direct interaction with Wnt proteins, and in a Wnt-independent beta catenin pathway through a receptor signaling pathway that may not use frizzled/LRP receptors. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination. |
| Involvement in Disease | Defects in RSPO1 are the cause of palmoplantar keratoderma with squamous cell carcinoma of skin and sex reversal (PKKSCC). This recessive syndrome is characterized by XX (female to male) SRY-independent sex reversal, palmoplantar hyperkeratosis and predisposition to squamous cell carcinoma of the skin. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Constituents: 0.16% Sodium phosphate, 0.87% Sodium chloride This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.