Recombinant Human IL-13 Protein (Active) (RMPP-00230097)
Cat. No.: RMPP-00230097
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
100 μg
50 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | ELISA; SDS-PAGE; WB |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: ELISA, SDS-PAGE, WB |
Protein Information
| UniProt ID | Q14766 |
|---|---|
| Molecular Weight | 36 kDa including tags |
| Sequence | CPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKE EPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLS |
| Sequence Similarities | Belongs to the LTBP family. Contains 18 EGF-like domains. Contains 4 TB (TGF-beta binding) domains. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted. |
| Tissue Specificity | Isoform Long is found in fibroblasts. |
| Domain | Associates covalently with small latent TGF-beta complex via domain TB 3. |
| Function | May be involved in the assembly, secretion and targeting of TGFB1 to sites at which it is stored and/or activated. May play critical roles in controlling and directing the activity of TGFB1. May have a structural role in the extra cellular matrix (ECM). |
| Post-translational Modifications | Contains hydroxylated asparagine residues.Isoform Short N-terminus is blocked.The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
