Recombinant Mouse IGF2 Protein (Active) (RMPP-00230663)
Cat. No.: RMPP-00230663
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
10 μg
1 mg
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: HEK 293 cells; Purity: > 90% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P01589 |
|---|---|
| Molecular Weight | 27 kDa including tags |
| Sequence | ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSW SSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHC REPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKT GWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTE TTAMTETFVLTMEYK |
| Sequence Similarities | Contains 2 Sushi (CCP/SCR) domains. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Function | Receptor for interleukin-2. |
| Involvement in Disease | Genetic variations in IL2RA are associated with susceptibility to diabetes mellitus insulin-dependent type 10 (IDDM10). A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: PBS, 5% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
