Recombinant Human FGFR2 (mutated E565G) Protein (Active) (RMPP-00230628)
Cat. No.: RMPP-00230628
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
5 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; ELISA; Surface Plasmon Resonance |
| Key Features | Expression system: HEK 293 cells; Purity: > 90% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, ELISA |
Protein Information
| UniProt ID | P15692 |
|---|---|
| Molecular Weight | 20 kDa including tags |
| Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQ LELNERTCRCDKPRR |
| Sequence Similarities | Belongs to the PDGF/VEGF growth factor family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin. |
| Tissue Specificity | Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. |
| Function | Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. |
| Involvement in Disease | Defects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 95% PBS, 5% TrehaloseLyophilized from 0.22 µm filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.