Recombinant Human BCL6B Protein (RMPP-00230501)
Cat. No.: RMPP-00230501
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
2 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. = 95% by HPLC. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | HPLC; SDS-PAGE; Functional Studies |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Active: Yes; Suitable for: HPLC, SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P22004 |
|---|---|
| Molecular Weight | 13 kDa |
| Sequence | VSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECS FPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSN VILKKYRNMVVRACGCH |
| Sequence Similarities | Belongs to the TGF-beta family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted. |
| Function | Induces cartilage and bone formation. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Constituent: 0.12% Tris This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
