Recombinant Human BCL9 Protein (RMPP-00230491)
Cat. No.: RMPP-00230491
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
10 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% HPLC. SDS-PAGE ≥ 95% |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | HPLC; SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: HPLC, SDS-PAGE |
Protein Information
| UniProt ID | P43489 |
|---|---|
| Molecular Weight | 29 kDa |
| Molecular Weight Information | Predicted Molecular weight is 21665.35 +/-10Da by ESI-TOF. |
| Sequence | LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSS KPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPC PPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQE TQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA |
| Sequence Similarities | Contains 4 TNFR-Cys repeats. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Function | Receptor for TNFSF4/OX40L/GP34. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.40Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
