Recombinant Human c-Kit (mutated V654A) Protein (Active) (RMPP-00230471)
Cat. No.: RMPP-00230471
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. > 95% by HPLC analysis. |
| Nature | Recombinant |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | HPLC; Functional Studies; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Active: Yes; Suitable for: HPLC, Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | O15520 |
|---|---|
| Molecular Weight | 19 kDa |
| Sequence | MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKY FLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKG KLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRR GQKTRRKNTSAHFLPMVVHS |
| Sequence Similarities | Belongs to the heparin-binding growth factors family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Could be a growth factor active in the process of wound healing. Acts as a mitogen in the lung. May act in a manner similar to FGF-7. |
| Involvement in Disease | Defects in FGF10 are the cause of autosomal dominant aplasia of lacrimal and salivary glands (ALSG). ALSG has variable expressivity, and affected individuals may have aplasia or hypoplasia of the lacrimal, parotid, submandibular and sublingual glands and absence of the lacrimal puncta. The disorder is characterized by irritable eyes, recurrent eye infections, epiphora (constant tearing) and xerostomia (dryness of the mouth), which increases the risk of dental erosion, dental caries, periodontal disease and oral infections.Defects in FGF10 are a cause of lacrimo-auriculo-dento-digital syndrome (LADDS); also known as Levy-Hollister syndrome. LADDS is a form of ectodermal dysplasia, a heterogeneous group of disorders due tothis product development of two or more ectodermal structures. LADDS is an autosomal dominant syndrome characterized by aplastic/hypoplastic lacrimal and salivary glands and ducts, cup-shaped ears, hearing loss, hypodontia and enamel hypoplasia, and distal limb segments anomalies. In addition to these cardinal features, facial dysmorphism, malformations of the kidney and respiratory system andthis product genitalia have been reported. Craniosynostosis and severe syndactyly are not observed. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
