Banner

Recombinant Human Calponin 1 Protein (RMPP-00230792)

Cat. No.: RMPP-00230792

Category: Recombinant Protein

Research Area: Immunology

INQUIRY 100 μg Customer Size

Product Features

Source HEK 293 cells
Purity ≥ 95% SDS-PAGE. Purity by HPLC ≥95%.
Nature Recombinant
Endotoxin Level < 0.005 Eu/µg
Carrier Free Yes
Animal Free Yes
Form Lyophilized
Applications SDS-PAGE; HPLC
Key Features Expression system: HEK 293 cells; Purity: ≥ 95% SDS-PAGE; Endotoxin level: < 0.005 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies, MS, Cell Culture, HPLC

Protein Information

UniProt ID P09603
Molecular Weight 19 kDa
Molecular Weight Information M +1 Da by ESI TOF (Calc. mass 18513 Da)

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQYIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN
Sequence EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYL KKAFLLVQYIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK ACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQD VVTKPDCN
Protein Length Protein fragment
Cellular Localization Cell membrane and Secreted > extracellular space.
Function Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy.
Post-translational Modifications Glycosylation and proteolytic cleavage yield different soluble forms. A high molecular weight soluble form is a proteoglycan containing chondroitin sulfate.Isoform 1 is N- and O-glycosylated. Isoform 3 is N-glycosylated.

Storage & Shipping

Shipping and Storage Shipped at Room Temperature. Store at Room Temperature.
pH: 6.00Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseBuffer reconstituted from.
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.