Recombinant Human CD10 Protein (RMPP-00230843)
Cat. No.: RMPP-00230843
Category: Recombinant Protein
Research Area: Tags & Cell Markers
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Active: Yes; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | P01034 |
|---|---|
| Molecular Weight | 16 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMSSPGKPPRLVGGPMDASVEEEGVRRALDF AVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPN LDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA |
| Sequence Similarities | Belongs to the cystatin family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Tissue Specificity | Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in various body fluids, such as the cerebrospinal fluid and plasma. Expressed in highest levels in the epididymis, vas deferens, brain, thymus, and ovary and the lowest in the submandibular gland. |
| Function | As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity. |
| Involvement in Disease | Amyloidosis 6Macular degeneration, age-related, 11 |
| Post-translational Modifications | The Thr-25 variant is O-glycosylated with a core 1 or possibly core 8 glycan. The signal peptide of the O-glycosylated Thr-25 variant is cleaved between Ala-20 and Val-21. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 8.00Constituents: 0.32% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
