Recombinant Human CD14 Protein (Active) (RMPP-00230061)
Cat. No.: RMPP-00230061
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
100 μg
50 μg
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | ELISA; SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: > 90% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: ELISA, SDS-PAGE |
Protein Information
| UniProt ID | P16070 |
|---|---|
| Molecular Weight | 22 kDa including tags |
| Sequence | QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKAL SIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYP SNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIP |
| Sequence Similarities | Contains 1 Link domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Isoform 10 (epithelial isoform) is expressed by cells of epithelium and highly expressed by carcinomas. Expression is repressed in neuroblastoma cells. |
| Domain | The lectin-like LINK domain is responsible for hyaluronan binding. |
| Function | Receptor for hyaluronic acid (HA). Mediates cell-cell and cell-matrix interactions through its affinity for HA, and possibly also through its affinity for other ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). Adhesion with HA plays an important role in cell migration, tumor growth and progression. Also involved in lymphocyte activation, recirculation and homing, and in hematopoiesis. Altered expression or dysfunction causes numerous pathogenic phenotypes. Great protein heterogeneity due to numerous alternative splicing and post-translational modification events. |
| Post-translational Modifications | Proteolytically cleaved in the extracellular matrix by specific proteinases (possibly MMPs) in several cell lines and tumors.N-glycosylated.O-glycosylated; contains more-or-less-sulfated chondroitin sulfate glycans, whose number may affect the accessibility of specific proteinases to their cleavage site(s).Phosphorylated; activation of PKC results in the dephosphorylation of Ser-706 (constitutive phosphorylation site), and the phosphorylation of Ser-672. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Please see notes section. pH: 7.40Constituent: 95% PBSab173996 was lyophilized from 0.22 µm filtered solution. 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
