Recombinant Mouse CD27 Protein (Tagged) (RMPP-00230416)
Cat. No.: RMPP-00230416
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
100 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. >95% by HPLC. |
| Nature | Recombinant |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE; HPLC |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Active: Yes; Suitable for: Functional Studies, SDS-PAGE, HPLC |
Protein Information
| UniProt ID | O76093 |
|---|---|
| Molecular Weight | 20 kDa |
| Sequence | AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISAR GEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKE CVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMK RYPKGQPELQKPFKYTTVTKRSR |
| Sequence Similarities | Belongs to the heparin-binding growth factors family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted. |
| Function | Plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. Required for normal ossification and bone development. Stimulates hepatic and intestinal proliferation. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
