Recombinant Human CNTF Protein (Active) (RMPP-00230137)
Cat. No.: RMPP-00230137
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
100 μg
50 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | ELISA; WB; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: ELISA, WB, SDS-PAGE |
Protein Information
| UniProt ID | P14136 |
|---|---|
| Molecular Weight | 76 kDa including tags |
| Sequence | MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRV DFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAE LNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLAT VRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFL RKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNM HEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVS EGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM |
| Sequence Similarities | Belongs to the intermediate filament family. |
| Protein Length | Full length protein |
| Cellular Localization | Cytoplasm. Associated with intermediate filaments. |
| Tissue Specificity | Expressed in cells lacking fibronectin. |
| Function | GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells. |
| Involvement in Disease | Defects in GFAP are a cause of Alexander disease (ALEXD). Alexander disease is a rare disorder of the central nervous system. It is a progressive leukoencephalopathy whose hallmark is the widespread accumulation of Rosenthal fibers which are cytoplasmic inclusions in astrocytes. The most common form affects infants and young children, and is characterized by progressive failure of central myelination, usually leading to death usually within the first decade. Infants with Alexander disease develop a leukoencephalopathy with macrocephaly, seizures, and psychomotor retardation. Patients with juvenile or adult forms typically experience ataxia, bulbar signs and spasticity, and a more slowly progressive course. |
| Post-translational Modifications | Phosphorylated by PKN1. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
