Recombinant Human CD276 Protein (Tagged) (Biotin) (RMPP-00230784)
Cat. No.: RMPP-00230784
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
50 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 97% SDS-PAGE. assessed also by HPLC analysis |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC |
| Key Features | Expression system: E.coli; Purity: > 97% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies, HPLC |
Protein Information
| UniProt ID | P01583 |
|---|---|
| Molecular Weight | 18 kDa |
| Sequence | SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQ QEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETP KLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSM TDFQIS |
| Sequence Similarities | Belongs to the IL-1 family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins. |
| Domain | The similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function. |
| Function | Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituent: 100% PBSLyophilized from a 0.2 µm filtered concentrated solution This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.