Recombinant Human CD31 Protein (RMPP-00230780)
Cat. No.: RMPP-00230780
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
200 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 98% SDS-PAGE. > 98% by HPLC analysis. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC |
| Key Features | Expression system: E.coli; Purity: > 98% SDS-PAGE; Active: Yes; Suitable for: SDS-PAGE, Functional Studies, HPLC |
Protein Information
| UniProt ID | P19875 |
|---|---|
| Molecular Weight | 8 kDa |
| Sequence | VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEV CLNPEAPLVQRIVQKILNKGKAN |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. |
| Post-translational Modifications | The N-terminal processed form GRO-beta(5-73) is produced by proteolytic cleavage after secretion from bone marrow stromal cells. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. pH: 7.40Constituent: 100% PBSLyophilized from a 0.2 µM filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
