Recombinant Human CLECL1 Protein (RMPP-00230455)
Cat. No.: RMPP-00230455
Category: Recombinant Protein
Research Area: Microbiology
INQUIRY
2 μg
Customer Size
Product Features
| Source | Mammalian |
|---|---|
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | Yes |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | Functional Studies; WB |
| Key Features | Expression system: Mammalian; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: Functional Studies, WB |
Protein Information
| UniProt ID | P56747 |
|---|---|
| Molecular Weight | 25 kDa including tags |
| Molecular Weight Information | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| Sequence | MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGL WMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLA GAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNP LVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARY STSAPAISRGPSEYPTKNYV |
| Sequence Similarities | Belongs to the claudin family. |
| Protein Length | Full length protein |
| Cellular Localization | Cell junction > tight junction. Cell membrane. |
| Function | Plays a major role in tight junction-specific obliteration of the intercellular space. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.4Constituents: 0.24% Tris, 0.87% Sodium chloride, 6% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
