Recombinant dog IL-4 Protein (Active) (RMPP-00230520)
Cat. No.: RMPP-00230520
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
5 μg
1 mg
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% HPLC. SDS-PAGE ≥ 95% |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Tags | Fc tag C-Terminus |
| Form | Lyophilized |
| Applications | HPLC; MS |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Tags: Fc tag C-Terminus; Suitable for: HPLC, SDS-PAGE, MS |
Protein Information
| UniProt ID | P42081 |
|---|---|
| Molecular Weight | 51 kDa including tags |
| Molecular Weight Information | Predicted MW is 51489.45 Da (+/- 10 Da by ESI-TOF). Observed MW is 51370.39 Da. |
| Sequence | APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKE KFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRI HQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLL RTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETD KTRLLSSPFSIELEDPQPPPDHIP |
| Sequence Similarities | Contains 1 Ig-like C2-type (immunoglobulin-like) domain. Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed by activated B-lymphocytes and monocytes. |
| Function | Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation. |
| Post-translational Modifications | Polyubiquitinated; which is promoted by MARCH8 and results in endocytosis and lysosomal degradation. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.40Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose |
|---|
For research use only. Not for clinical use.
