Recombinant Human alpha smooth muscle Actin Protein (RMPP-00230842)
Cat. No.: RMPP-00230842
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
50 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 90% SDS-PAGE; Suitable for: SDS-PAGE, MS |
Protein Information
| Molecular Weight | 11 kDa |
|---|---|
| Sequence | DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYG NHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVA TEC |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted |
| Relevance | Anti mullerian hormone (AMH) is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. Originally classified as a foetal testicular hormone that inhibits Mullerian duct development, AMH is expressed post natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.2Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine) |
|---|
For research use only. Not for clinical use.
