Recombinant Human CTNNBIP1/ICAT Protein (RMPP-00230839)
Cat. No.: RMPP-00230839
Category: Recombinant Protein
Research Area: Cell Biology
INQUIRY
100 μg
500 μg
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% SDS-PAGE; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | Q07011 |
|---|---|
| Molecular Weight | 17 kDa |
| Molecular Weight Information | Mass determination by ESI TOF: Predicted MW is 17336.42 +/- 10Da. Observed MW is 17337.75 Da. |
| Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFR TRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFG TFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVT PPAPAREPGHSPQ |
| Sequence Similarities | Contains 4 TNFR-Cys repeats. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed on the surface of activated T-cells. |
| Function | Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.4Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
