Recombinant Human CXCR4 Protein (RMPP-00230446)
Cat. No.: RMPP-00230446
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
10 μg
Customer Size
Product Features
| Source | Baculovirus infected insect cells |
|---|---|
| Purity | > 75% SDS-PAGE. The purity was determined to be >75% by densitometry. Affinity purified. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | Functional Studies; SDS-PAGE; WB |
| Key Features | Expression system: Baculovirus infected insect cells; Purity: > 75% SDS-PAGE; Suitable for: Functional Studies, SDS-PAGE, WB |
Protein Information
| UniProt ID | Q96DB2 |
|---|---|
| Molecular Weight | 66 kDa including tags |
| Sequence | MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLK EEKLLSDSMLVEAREASEEDLLVVHTRRYLNELKWSFAVATITEIPPVIF LPNFLVQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGGFHHCSSDRGG GFCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMDDKRVYI MDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKSLQEHL PDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRGRRVPILMVT SGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP |
| Sequence Similarities | Belongs to the histone deacetylase family. |
| Protein Length | Full length protein |
| Cellular Localization | Nucleus. Predominantly nuclear. |
| Tissue Specificity | Weakly expressed in most tissues. Strongly expressed in brain, heart, skeletal muscle, kidney and testis. |
| Function | Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 7.50Constituents: 0.307% Glutathione, 0.00174% PMSF, 0.00385% DTT, 0.79% Tris HCl, 0.00292% EDTA, 25% Glycerol (glycerin, glycerine), 0.87% Sodium chloride |
|---|
For research use only. Not for clinical use.
